Protein Info for MPMX26_02575 in Acinetobacter radioresistens SK82

Annotation: tRNA threonylcarbamoyladenosine biosynthesis protein TsaB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03725: tRNA threonylcarbamoyl adenosine modification protein YeaZ
  • amino acids 3 to 208 (206 residues), 168.4 bits, E=1.1e-53
• PF00814: TsaD
  • amino acids 35 to 144 (110 residues), 84.4 bits, E=5.6e-28

Best Hits

KEGG orthology group: K14742, hypothetical protease [EC: 3.4.-.-] (inferred from 71% identity to acd:AOLE_16255)

Predicted SEED Role

"TsaB protein, required for threonylcarbamoyladenosine (t(6)A) formation in tRNA"

KEGG Metabolic Maps

• Biotin metabolism
• Lysine degradation
• Peptidoglycan biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.4.-.-

Use Curated BLAST to search for 3.4.-.-

Protein Sequence (221 amino acids)

>MPMX26_02575 tRNA threonylcarbamoyladenosine biosynthesis protein TsaB (Acinetobacter radioresistens SK82)
MKLLALETANEQCSVSIVDDAQELFFQLDERTKAQTQMILPMIEKGLQQTSLQLEQLSAI
AFSRGPGSFSGVRINAAVTQALAWANDLPVIPVSTLQALAQAAYRLTGLKEVSAVLDARM
QEVYIGSFQLDEQHIMRPVAEEQLLDYETARQAVQFPLVGSGSALVDTAQVNYQQITATA
QDIAAIARVQALKAEWLSAEQALPVYLRDNAWKKIPEQGKA