Protein Info for MPMX26_02572 in Acinetobacter radioresistens SK82

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 475 transmembrane" amino acids 39 to 60 (22 residues), see Phobius details amino acids 72 to 90 (19 residues), see Phobius details amino acids 99 to 123 (25 residues), see Phobius details amino acids 136 to 157 (22 residues), see Phobius details amino acids 164 to 183 (20 residues), see Phobius details PF00656: Peptidase_C14" amino acids 279 to 421 (143 residues), 23.5 bits, see alignment E=4.3e-09 PF01650: Peptidase_C13" amino acids 296 to 436 (141 residues), 113.3 bits, see alignment E=1.5e-36

Best Hits

KEGG orthology group: None (inferred from 80% identity to aci:ACIAD0681)

Predicted SEED Role

"MORN repeat family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (475 amino acids)

>MPMX26_02572 hypothetical protein (Acinetobacter radioresistens SK82)
MINLKPSINFWHDFQSNQIAGMWLFLGSRRALAAVRPSILQFIVWGVLGGLANTLFSWLT
AGETGEFNSQGLVSYALWPFLALIVGIFLSQRTNNPRLMLVPTILWLILDTHIALLQSLI
QYLGQLDYLPYAIYDYLPILFMVLFVWQSMAVVWVFGRELKWPWWEFALIMLATFITLVV
WQMSVKDQPIWKVESVPPSFSEEAFYKQSQILNRTLEDVEYGEFAQTHWYFLGVAGASYQ
DVFKSEVKRIREQFDTRFGTFGRSVMLINNPQTRTEIPIASRTSINLALRRIGQQMNRES
DVLFLYMTSHGLQNQFEIENAPLELDQVDPKWLREALDRSGIRWRVIVISACYSGSFIPA
LQSANTLIITASAADRASFGCSNEADYTYFGRAFFDQAMREQSSLKTAFEQARSTVATWE
NAQGFDPSEPQWVIGKNMELMLPQLEQRLFPATTANQPNLSLAVSQSAQLERAGK