Protein Info for MPMX26_02558 in Acinetobacter radioresistens SK82

Annotation: Adaptive-response sensory-kinase SasA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 239 to 261 (23 residues), see Phobius details PF00672: HAMP" amino acids 265 to 309 (45 residues), 39.8 bits, see alignment 6.9e-14 PF00512: HisKA" amino acids 314 to 379 (66 residues), 48.6 bits, see alignment E=1e-16 PF02518: HATPase_c" amino acids 426 to 534 (109 residues), 84.7 bits, see alignment E=9.6e-28

Best Hits

KEGG orthology group: K07639, two-component system, OmpR family, sensor histidine kinase RstB [EC: 2.7.13.3] (inferred from 82% identity to aci:ACIAD0727)

Predicted SEED Role

"Sensory histidine kinase in two-component regulatory system with RstA" in subsystem Orphan regulatory proteins

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (550 amino acids)

>MPMX26_02558 Adaptive-response sensory-kinase SasA (Acinetobacter radioresistens SK82)
MFKHSIFLRIYAGLVVLVALVAVFGYLLVQIINYQRAQEYRESLTDGISYVISEGVSRQP
SEQQKLDWIADASDLLELSIYYVDASKVELSRAERKRINNLQAVVRYDAKNTTAYIILGL
KDDPKHYLYVKVDKIGERQMKALPIFILDYLIYYPGQEREYLAKIQKYFTYPISIQNLHE
LQLDSEQIGQLRQDQSIMLYKDSATMRGTNITIISPMPSNPSEVLVIGPVPVFNWMPFQL
AGGITLLSLFLLSLGVYGLIVPLERKIRQVRYALNRMKSGDLSLRVPIEGNDEMANLAAS
YNNMSDHIQRLIEAQRELMRAVSHELRTPVARIRFGMEMLAEEDDYEYRLQQIEMIDKDI
EALNTLIDEIMTYAKLEQGTPSLEFEELPLVEVLSQVATETEALKTQKEIELLAPAPDLR
VDAERRYLHRVVQNLVGNAVRYCDHKVRISGGIDKDGKAYVSVEDDGAGIPEIDRARIFE
AFARLDDSRTRASGGYGLGLSIVSRIAYWFGGTIQVDQSPDLGGARFIMTWPAQRFKHEA
RKNRIDKKST