Protein Info for MPMX26_02552 in Acinetobacter radioresistens SK82

Annotation: NADH-quinone oxidoreductase subunit E

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 56% identical to NUOE_PSEAE: NADH-quinone oxidoreductase subunit E (nuoE) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00334, NADH dehydrogenase I subunit E [EC: 1.6.5.3] (inferred from 92% identity to aci:ACIAD0734)

MetaCyc: 56% identical to NADH-quinone oxidoreductasesubunit E (Pseudomonas putida KT2440)
NADH-DEHYDROG-A-RXN [EC: 7.1.1.2]

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain E (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

aerobic respiration III (alternative oxidase pathway) (3/3 steps found)
NADH to cytochrome bd oxidase electron transfer I (2/2 steps found)
NADH to cytochrome bo oxidase electron transfer I (1/2 steps found)
aerobic respiration I (cytochrome c) (2/4 steps found)
NAD(P)/NADPH interconversion (3/6 steps found)
Fe(II) oxidation (1/6 steps found)

KEGG Metabolic Maps

Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3 or 7.1.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (169 amino acids)

>MPMX26_02552 NADH-quinone oxidoreductase subunit E (Acinetobacter radioresistens SK82)
MMILTDKKPRVNVEGILTSEEIHEIQHHIGHYPYARAASLDALKCVQRRNGWVDDAQLNA
IAQLLSISTADLEGVATFYNRIYRQPVGRHVILLCDSIACFLMGAETLAEAFQRELGIQF
GQTTADGRFTLLPICCLGNCDKGPTLMIDGDTHGLVEVTSIQQLLEKYV