Protein Info for MPMX26_02537 in Acinetobacter radioresistens SK82

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 653 transmembrane" amino acids 25 to 47 (23 residues), see Phobius details amino acids 83 to 101 (19 residues), see Phobius details amino acids 114 to 137 (24 residues), see Phobius details amino acids 173 to 196 (24 residues), see Phobius details amino acids 208 to 227 (20 residues), see Phobius details amino acids 259 to 282 (24 residues), see Phobius details amino acids 298 to 318 (21 residues), see Phobius details amino acids 353 to 372 (20 residues), see Phobius details amino acids 385 to 410 (26 residues), see Phobius details amino acids 429 to 448 (20 residues), see Phobius details amino acids 454 to 476 (23 residues), see Phobius details PF05552: MS_channel_1st_1" amino acids 26 to 57 (32 residues), 32.5 bits, see alignment (E = 3.3e-12) amino acids 108 to 155 (48 residues), 61.3 bits, see alignment 3.2e-21 amino acids 198 to 241 (44 residues), 45.1 bits, see alignment 3.8e-16 amino acids 289 to 337 (49 residues), 45.9 bits, see alignment 2.1e-16

Best Hits

KEGG orthology group: None (inferred from 74% identity to acd:AOLE_15830)

Predicted SEED Role

"Small-conductance mechanosensitive channel"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (653 amino acids)

>MPMX26_02537 hypothetical protein (Acinetobacter radioresistens SK82)
MNDYYAGGARGPGFDAMYYWDQFHPIIAAVVILILGWIIALVIAAGVKKLLQKMNTNHKL
SNAAGHTTTTGTSPNYEGLFSRIVFWFILIIAIIAALNVLNINSVSGPFSNMISQVLVFI
PNLIAAIAVGFIGWLVARLVRTGLTKVLARTQLDEKLSNDVGVSPISKNIADIIYWLILL
LFLPIVLSILGLDGLLVPVQNLVNKAALYIPNIFMAAIILFAGYILAKIVRGIVEGLVNS
LDLQTQVQKVGLFKNSNLPGFLGSFVFAIIMITALIVAFEALGIQSISQPATAMLYEIMN
AIPHIIAAGLILILAYIVSRFVGRLVAELIAGTGADELPAKVGVQRFMGNAKVSSIVGYL
IVFFTMLFALSEAANRLGFEQVSALIAMFIYFGANILLGAVILVVGFWLANIVANVVERG
EYNSSRWLGCLVRVLIMGLVIAMGLRAMGIADSIVNLAFGLTLGAVAVAFALAFGLGGRQ
PAERVLTDLIDKAKREANHPNPLRNNDSGTTSSTMTSTTGSFTAAHTPATSPSMTSSQGT
DTSAAKSSELSMDGASSQVTDSTTKTAENGTFMPDTDNDTNAPMRTDLSNTTPATLTTAP
YGDDEASGIDQVTPDSVGVNPVNPPTNNPFGSTGEAEPNVDANKNPEKKDDQK