Protein Info for MPMX26_02533 in Acinetobacter radioresistens SK82

Annotation: D-cysteine desulfhydrase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 PF00291: PALP" amino acids 16 to 281 (266 residues), 58.6 bits, see alignment E=3.3e-20

Best Hits

KEGG orthology group: K01505, 1-aminocyclopropane-1-carboxylate deaminase [EC: 3.5.99.7] (inferred from 65% identity to abb:ABBFA_002839)

Predicted SEED Role

"1-aminocyclopropane-1-carboxylate deaminase (EC 3.5.99.7)" (EC 3.5.99.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.99.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (298 amino acids)

>MPMX26_02533 D-cysteine desulfhydrase (Acinetobacter radioresistens SK82)
MLDLLAQPVPYQTIIQHAQLSLTVKRLDLVHPEISGNKFYKLKNNIHFALAEGFKQLLTF
GGAFSNHIAATAAAGKLAGLSTIGIIRGEELAQRPFNPTLMQAQANGMQLYFISRHEYKY
RADQAYLQTLQQRFPQAYIIPEGGTNSLAVTGCKEILSSQDLENYDVFCCAVGTGGTMSG
LIEASSEQHQVLGFPVLKGNFLQAEITQWTNKTHWQLLQDYHFGGYAKTTPALLDFIQHF
KKAYSIPLEPIYTAKMLFGLIDLIQKNYFQPHTRILAIHSGGLQGFPLHPESFSENRL