Protein Info for MPMX26_02528 in Acinetobacter radioresistens SK82

Annotation: Threonine efflux protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 207 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 41 to 66 (26 residues), see Phobius details amino acids 71 to 89 (19 residues), see Phobius details amino acids 118 to 140 (23 residues), see Phobius details amino acids 146 to 173 (28 residues), see Phobius details amino acids 185 to 204 (20 residues), see Phobius details PF01810: LysE" amino acids 17 to 203 (187 residues), 111.5 bits, see alignment E=1.8e-36

Best Hits

KEGG orthology group: K05835, threonine efflux protein (inferred from 74% identity to aby:ABAYE3033)

Predicted SEED Role

"L-lysine permease" in subsystem Lysine degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (207 amino acids)

>MPMX26_02528 Threonine efflux protein (Acinetobacter radioresistens SK82)
MESLFIIGSIALALMLGAISPGPTFIYVAKNSIAISRKHGLFTALGTGTGAALFGFLAVM
GLQAILLAVPSAYFILKVCGGLYLLWLAYKIIKHAKEPMGSTYGSVQPMSYAQAYRLGLI
TQLSNPKISIILASIFTALLPKEIPAYFYVVLPLLCFFIDAGWYSLVAVALSAEKPRQVY
LKFKAIFDRIAGGVMTLLGLKLIFGMK