Protein Info for MPMX26_02525 in Acinetobacter radioresistens SK82

Annotation: Iron-sulfur cluster carrier protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 409 PF10609: ParA" amino acids 153 to 394 (242 residues), 331 bits, see alignment E=1.1e-102 PF13614: AAA_31" amino acids 155 to 193 (39 residues), 34.7 bits, see alignment 4.2e-12 PF09140: MipZ" amino acids 156 to 303 (148 residues), 33.8 bits, see alignment E=5.6e-12 PF01656: CbiA" amino acids 157 to 325 (169 residues), 43.5 bits, see alignment E=7.3e-15

Best Hits

Predicted SEED Role

"Mrp protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (409 amino acids)

>MPMX26_02525 Iron-sulfur cluster carrier protein (Acinetobacter radioresistens SK82)
MSWFSSLKSVFSPAKGVKEEEIQQVLQNYVLPHSNNRLQDRITQLQLHEATLQLTIKTYP
EEKPYLQQLHDELADQLEKCGLQELNLHVIQQKNNLAAATPAQDNQSEKSSLPPVVDASA
QVSPNTAPDNDPNNLPIEKAAPQQRDVPKHLRIQNIILVSSGKGGVGKSTTTVNLALALQ
KLGLKVGVLDADIYGPSIPTMLGNAGHTPLIEAENFVPLEAYGMAVLSIGHLTGDHNTPV
AWRGPKATGALMQLFNQTLWPELDVLVIDMPPGTGDIQLTLAQRIPVTGAVIVTTPQNVA
LMDATKGIELFNKVQIPVLGVIENMSTHICSNCGHEEQIFGTGGGDQLADQYQIPLLGRL
PLNVQIRENADAGKPSVIAEDEAAESYIEIARKIAEKLPQHSRDEKRIF