Protein Info for MPMX26_02510 in Acinetobacter radioresistens SK82

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 693 transmembrane" amino acids 46 to 67 (22 residues), see Phobius details amino acids 323 to 345 (23 residues), see Phobius details PF00015: MCPsignal" amino acids 474 to 657 (184 residues), 137.3 bits, see alignment E=2.4e-44

Best Hits

KEGG orthology group: K02660, twitching motility protein PilJ (inferred from 77% identity to abc:ACICU_03060)

Predicted SEED Role

"type IV pilus biogenesis protein PilJ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (693 amino acids)

>MPMX26_02510 hypothetical protein (Acinetobacter radioresistens SK82)
MGFKLKKKNTGESGAAHSSNAFLTKIQTQVEDFARLFGDSSKSKPFIYGAALSLILSVIL
LLFLFYSVPRHNELTRSLGELRLLSQTISRQATEATASGTPESIKTLSQSQARFAENLET
VQDIHGSTDAEVRQVEQTWNAVSRNIDQITSQQKIINKLYDTNIAISETIPGIQAEYNLL
VDQMARQNMSSSQVVIAKNQVFIAERILRSISSVLVGNDSSRESADDFNADTETFGTYLN
AQLNGSSELGVERINDPALRESLTNIQDEYNAVLKSAAATVLNNSNQIVQVRQASAQIFS
QSDELLAALNKLTESASSNWAEVALAILLLASIAALIFSVIKLLALRGATDKQRVTRLQD
EYDRNQNAILRLLDEIADLADGDLRSYATVSEDFTGAIADSINFAIDQLRDLVSRINETS
QEVSRYTQNTQNITNQLAEASEHQAQEIAGASSAISEMATSIDQVSANASESAEVAQRSV
QIASNGADVVNRSIEGMDTIREQIQETSKRIKRLGESSQEIGNIVSLINDIADQTNILAL
NAAIQASMAGEAGRGFAVVADEVQRLAERSTSATKQIETLVKTIQADTNEAVISMEQTTA
EVVRGANLAKDAGIALDEIQKVSGDLAKLIASISDAAKLQAASAGHISSTMSIVQEITSQ
TTSATFDTARSVSELASMAESLRESVTDFKLPE