Protein Info for MPMX26_02493 in Acinetobacter radioresistens SK82

Annotation: Outer membrane protein Omp38

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 348 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF13505: OMP_b-brl" amino acids 7 to 189 (183 residues), 44.6 bits, see alignment E=2.8e-15 PF05736: OprF" amino acids 49 to 194 (146 residues), 25.2 bits, see alignment E=1.9e-09 PF00691: OmpA" amino acids 232 to 328 (97 residues), 73.1 bits, see alignment E=3.2e-24

Best Hits

Swiss-Prot: 84% identical to OMP38_ACIBT: Outer membrane protein Omp38 (omp38) from Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)

KEGG orthology group: K03286, OmpA-OmpF porin, OOP family (inferred from 85% identity to aci:ACIAD0697)

Predicted SEED Role

"OprF"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (348 amino acids)

>MPMX26_02493 Outer membrane protein Omp38 (Acinetobacter radioresistens SK82)
MKLSRIALAMLVAAPLAAANAGVTITPLMLGYTMFDTQHNNGGNDGDLTDSVELDDDLFV
GAALGVELTPWLGFEAEYSQIKGDTSVAGNEYKGENIAGNFYVTSDLFTKNYDSKIKPYA
LLGAGHYKYEFDTDAGRAGRGLDEEGTLGNAGLGAFWRINDALSLRTEARGTYHFDEQFW
NYTALAGLNVVLGGHLKPAAPVVEVVPVEPTPIVEPQPQELTEDLNMELRVFFDTNKSNI
KDQYKPEIAKVAEKLVEYPNATARIDGHTDNTGPRALNERLSLARANSVKSSLVNEYNID
PSRLTAQGFAWDQPIADNSTKEGRAMNRRVFATITGSRTVVAQPGQAQ