Protein Info for MPMX26_02491 in Acinetobacter radioresistens SK82

Annotation: Ribosomal RNA small subunit methyltransferase C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 PF08468: MTS_N" amino acids 5 to 156 (152 residues), 154.8 bits, see alignment E=6e-49 PF05175: MTS" amino acids 165 to 333 (169 residues), 183.3 bits, see alignment E=9.2e-58 PF06325: PrmA" amino acids 195 to 269 (75 residues), 30.5 bits, see alignment E=8.2e-11 PF08241: Methyltransf_11" amino acids 200 to 302 (103 residues), 24.1 bits, see alignment E=1.4e-08 PF08242: Methyltransf_12" amino acids 200 to 299 (100 residues), 31.6 bits, see alignment E=6.6e-11 PF13649: Methyltransf_25" amino acids 200 to 298 (99 residues), 29.6 bits, see alignment E=2.9e-10

Best Hits

Swiss-Prot: 72% identical to RSMC_ACIBT: Ribosomal RNA small subunit methyltransferase C (rsmC) from Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)

KEGG orthology group: K00564, ribosomal RNA small subunit methyltransferase C [EC: 2.1.1.172] (inferred from 72% identity to abc:ACICU_03085)

Predicted SEED Role

"Ribosomal RNA small subunit methyltransferase C (EC 2.1.1.52)" (EC 2.1.1.52)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.172 or 2.1.1.52

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (338 amino acids)

>MPMX26_02491 Ribosomal RNA small subunit methyltransferase C (Acinetobacter radioresistens SK82)
MDPRSEVVLRQIDQLSGQVLFIHAPNDQLLNQLGPRIDASIWTWNFSDYQGFQAAGFKTH
FGVDFPQQQFNQVVIFVPKSKELLNYVLHNIVSHLEIGQSVFLVGEKKGGVERAAKQLHT
FGHPVKLDSARHCQFWQLKLEHIEQQKPLESWLKTYTVQLKDQQIEICALPGVFSQSHLD
VGTAVLIPYLDQVKSGTLADFGCGAGVIACYLAKSNPANTVYALDVDAFALRSTELTFQR
NQVPASQLRLQPVSSIADAPFELDAIVSNPPFHQGIHTHYEASEELCKTAPQHLKNGGEL
WIVANRFLNYPHLIEQRFGQCTLKADQQGFKVLYACAR