Protein Info for MPMX26_02477 in Acinetobacter radioresistens SK82

Annotation: Dual-specificity RNA pseudouridine synthase RluA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 221 TIGR00005: pseudouridine synthase, RluA family" amino acids 11 to 220 (210 residues), 194.7 bits, see alignment E=1.1e-61 PF00849: PseudoU_synth_2" amino acids 24 to 171 (148 residues), 116.3 bits, see alignment E=7.5e-38

Best Hits

Swiss-Prot: 51% identical to RLUA_VIBPA: Ribosomal large subunit pseudouridine synthase A (rluA) from Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)

KEGG orthology group: K06177, ribosomal large subunit pseudouridine synthase A [EC: 5.4.99.12] (inferred from 76% identity to acd:AOLE_18880)

Predicted SEED Role

"Ribosomal large subunit pseudouridine synthase A (EC 4.2.1.70)" in subsystem Ribosome biogenesis bacterial (EC 4.2.1.70)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.70, 5.4.99.12

Use Curated BLAST to search for 4.2.1.70 or 5.4.99.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (221 amino acids)

>MPMX26_02477 Dual-specificity RNA pseudouridine synthase RluA (Acinetobacter radioresistens SK82)
MALNQPFIYAPPQQPLSIIYEDDDLIIIDKPAGLLSVPGRLPEHQDSAYLRLLEKYPHAK
ITHRLDMATSGILMFAKHRDAEVAISKMFQARTVTKRYVALIQGQLNEQGSIDVPLITDW
ENRPRQIVHFELGKSAKTLFQVLQYHEEHDMTRVLLTPITGRSHQLRVHMQYIGHPIMGD
KLYHPEPGGFYLRRMALHASYLAFQQPLSKDLIEINMAIPF