Protein Info for MPMX26_02464 in Acinetobacter radioresistens SK82

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 270 transmembrane" amino acids 6 to 36 (31 residues), see Phobius details amino acids 46 to 69 (24 residues), see Phobius details amino acids 75 to 99 (25 residues), see Phobius details amino acids 106 to 123 (18 residues), see Phobius details amino acids 143 to 167 (25 residues), see Phobius details amino acids 179 to 200 (22 residues), see Phobius details amino acids 212 to 233 (22 residues), see Phobius details amino acids 249 to 268 (20 residues), see Phobius details PF01925: TauE" amino acids 7 to 260 (254 residues), 180.6 bits, see alignment E=2.1e-57

Best Hits

KEGG orthology group: None (inferred from 82% identity to aci:ACIAD0842)

Predicted SEED Role

"Protein of unknown function DUF81" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (270 amino acids)

>MPMX26_02464 hypothetical protein (Acinetobacter radioresistens SK82)
MMELIIYLLIGAIAGFAAGLFGVGGGLIIVPILYIVFTQLNYDPNVLMHMAVGTSLATII
VTSISSVMAHHKRGAVLWAVFKNLAPGLVLGSFLGAGVADLLSGQHLQLAIGLFAIWVAY
KMFRGAHVQVNPDRTLPSAPVQMLAGGGIGIASAIFGIGGGSLTVPYLNRHGVIMQKAVA
TSAACGLPIAIAGALGFIWFGRQANVEVPNAIGYVHIYAFIGISTMSFITAKLGARVAHM
LSPTMLKKCFAGLLSVVGLYFIYQAVSIYF