Protein Info for MPMX26_02459 in Acinetobacter radioresistens SK82

Annotation: Inner membrane protein YbjJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 399 transmembrane" amino acids 25 to 43 (19 residues), see Phobius details amino acids 55 to 77 (23 residues), see Phobius details amino acids 84 to 103 (20 residues), see Phobius details amino acids 109 to 134 (26 residues), see Phobius details amino acids 146 to 167 (22 residues), see Phobius details amino acids 173 to 194 (22 residues), see Phobius details amino acids 217 to 237 (21 residues), see Phobius details amino acids 255 to 276 (22 residues), see Phobius details amino acids 288 to 306 (19 residues), see Phobius details amino acids 312 to 331 (20 residues), see Phobius details amino acids 343 to 366 (24 residues), see Phobius details amino acids 373 to 391 (19 residues), see Phobius details PF07690: MFS_1" amino acids 27 to 329 (303 residues), 70.7 bits, see alignment E=5.4e-24 amino acids 227 to 392 (166 residues), 38.1 bits, see alignment E=4.4e-14

Best Hits

KEGG orthology group: None (inferred from 70% identity to acd:AOLE_15655)

Predicted SEED Role

"putative transport protein (permease)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (399 amino acids)

>MPMX26_02459 Inner membrane protein YbjJ (Acinetobacter radioresistens SK82)
MILFSRTAVLDSAAQLSAQRLSTRLNFFSLGFGTAAWAPLIPFAQQRLNLNHADFGLLLL
CMGVGSMIAMPATGALVQRIGCRAIIGFAALLILLVLPGLAVWNTSVMMAVSLFLFGTAA
GSFGVALNLQAVIVEKNSLRAMMSSFHGMCSLGGLAGVMTVTALLAAGVSPLISALAVSI
MLFVISIIAVPASLSEIERDEQIEADTAEHKKSHKKLPAPIILLIGLMCFIAFLSEGAAM
DWSGIYLTSKYGVNPAFAGLAYTFFAIAMTLGRFSGRYLLKILGEKNIVTYSAICAATGL
AVVVLAPHWFIVLLGYALVGLGCSNIVPVMFSRVGRQNFMPKAAALSCVSTMAYTGSLSG
PALIGVIGEMTGLTIMFASVAVLLATVAILNRFTRVGPA