Protein Info for MPMX26_02453 in Acinetobacter radioresistens SK82

Annotation: 8-amino-7-oxononanoate synthase 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 385 transmembrane" amino acids 270 to 288 (19 residues), see Phobius details PF00155: Aminotran_1_2" amino acids 39 to 383 (345 residues), 169.6 bits, see alignment E=6e-54

Best Hits

Swiss-Prot: 58% identical to BIOF_PASMU: Putative 8-amino-7-oxononanoate synthase (bioF) from Pasteurella multocida (strain Pm70)

KEGG orthology group: K00652, 8-amino-7-oxononanoate synthase [EC: 2.3.1.47] (inferred from 72% identity to aci:ACIAD0857)

Predicted SEED Role

"8-amino-7-oxononanoate synthase (EC 2.3.1.47)" in subsystem Biotin biosynthesis (EC 2.3.1.47)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.47

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (385 amino acids)

>MPMX26_02453 8-amino-7-oxononanoate synthase 2 (Acinetobacter radioresistens SK82)
MKLLEHYTKQLEQLRQQGNFRQFTANRQQGRIIEIAGQHMLNLSSNDYLGLAADLELRQV
FFDQCPLEQRWLSSSSSRLLTGNFPEYEQLEACMSQAFDGRAVLLFNSGYHMNIGILPAL
SDGKTLILADKLVHASMIDGIRLSSAKYLRYRHNDLNHLQQLLQKYHADDTYERIIVVTE
SIFSMDGDETDLNQLVSLKRQFAKVMLYVDEAHAIGVRGARGLGCAEQYAVINQIDFLVG
TFGKALASVGGYLVCEPVIREYLINSMRPLIFSTALPPLSIAWTRFVFEHMQKMQKQRDH
LVNLSHHLQHKVQSLGFCCPSSSHIVPVIIGDSQPAVDKANYLQAQGFYIMPVRPPTVPA
NSARLRISLTSQIQPEEIEQLVALL