Protein Info for MPMX26_02452 in Acinetobacter radioresistens SK82

Annotation: Malonyl-[acyl-carrier protein] O-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 TIGR02072: malonyl-acyl carrier protein O-methyltransferase BioC" amino acids 15 to 258 (244 residues), 224.9 bits, see alignment E=6.7e-71 PF05401: NodS" amino acids 35 to 147 (113 residues), 30.8 bits, see alignment E=7.7e-11 PF13489: Methyltransf_23" amino acids 50 to 184 (135 residues), 53.7 bits, see alignment E=6.3e-18 PF13847: Methyltransf_31" amino acids 51 to 182 (132 residues), 42.1 bits, see alignment E=2.4e-14 PF13649: Methyltransf_25" amino acids 52 to 140 (89 residues), 51.1 bits, see alignment E=5.4e-17 PF08242: Methyltransf_12" amino acids 53 to 142 (90 residues), 46 bits, see alignment E=2.2e-15 PF08241: Methyltransf_11" amino acids 53 to 144 (92 residues), 57.7 bits, see alignment E=4.8e-19

Best Hits

Swiss-Prot: 49% identical to BIOC_ACIAD: Malonyl-[acyl-carrier protein] O-methyltransferase (bioC) from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)

KEGG orthology group: K02169, biotin synthesis protein BioC (inferred from 58% identity to acd:AOLE_15625)

Predicted SEED Role

"Biotin synthesis protein BioC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (260 amino acids)

>MPMX26_02452 Malonyl-[acyl-carrier protein] O-methyltransferase (Acinetobacter radioresistens SK82)
MSQNFHIDTGLIAQRFAKAASSYSEHAVAQKIICQRLIEMMRRHIAIQIPRVLELGCGSG
HLTILLQQNFQIEQLILNDLYPEVRQHFSAAEQLDWCIGDIERLDFPEQLDAIMSSSVLQ
WMHDLEQVFNKCSEALKPQGWFCFSSFGSENLREIKTLTGQGLNYLSLEELKEKMCKSGF
EVLEIQEEQETLYFEHPKQVLQHLKLTGVTATSSQHRWTKQSLYKFYDQYQQFVKSPAYE
GIQQYPLTYHPIYCIARRVR