Protein Info for MPMX26_02451 in Acinetobacter radioresistens SK82

Annotation: ATP-dependent dethiobiotin synthetase BioD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 214 PF13500: AAA_26" amino acids 6 to 182 (177 residues), 123 bits, see alignment E=7.4e-40 TIGR00347: dethiobiotin synthase" amino acids 7 to 176 (170 residues), 164.6 bits, see alignment E=1.1e-52

Best Hits

Swiss-Prot: 61% identical to BIOD_NEIG2: ATP-dependent dethiobiotin synthetase BioD (bioD) from Neisseria gonorrhoeae (strain NCCP11945)

KEGG orthology group: K01935, dethiobiotin synthetase [EC: 6.3.3.3] (inferred from 72% identity to abc:ACICU_00767)

Predicted SEED Role

"Dethiobiotin synthetase (EC 6.3.3.3)" in subsystem Biotin biosynthesis (EC 6.3.3.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.3.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (214 amino acids)

>MPMX26_02451 ATP-dependent dethiobiotin synthetase BioD (Acinetobacter radioresistens SK82)
MTGSIYFVSGIDTGIGKTFATGYLAKIWNEHGTRTITQKLVQTGNINISEDIEQHRTIMG
MGWFAEDEEKLTMPEILSYPASPHLATKIDGREIDLDKIHAATQELARRYDAVLLEGAGG
LMVPLTDDVLTIDHIAAHQFPVILVTSGRLGSINHTLLSLELLKSRGVELFAVAYNGMDD
SQDPLIACDTSNYLRAYMTKHFPEAEWIEIPVIR