Protein Info for MPMX26_02450 in Acinetobacter radioresistens SK82

Annotation: Ribosomal large subunit pseudouridine synthase B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 301 PF01479: S4" amino acids 4 to 48 (45 residues), 44 bits, see alignment 1.5e-15 PF00849: PseudoU_synth_2" amino acids 67 to 199 (133 residues), 76 bits, see alignment E=3.8e-25 TIGR00093: pseudouridine synthase" amino acids 71 to 231 (161 residues), 170.9 bits, see alignment E=8.9e-55

Best Hits

Swiss-Prot: 57% identical to RLUB_VIBCH: Ribosomal large subunit pseudouridine synthase B (rluB) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K06178, ribosomal large subunit pseudouridine synthase B [EC: 5.4.99.12] (inferred from 93% identity to aci:ACIAD0861)

Predicted SEED Role

"Ribosomal large subunit pseudouridine synthase B (EC 4.2.1.70)" in subsystem Two cell division clusters relating to chromosome partitioning (EC 4.2.1.70)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.70, 5.4.99.12

Use Curated BLAST to search for 4.2.1.70 or 5.4.99.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (301 amino acids)

>MPMX26_02450 Ribosomal large subunit pseudouridine synthase B (Acinetobacter radioresistens SK82)
MSEKLQKVLARIGLGSRRYMEEVIAAGRVSVNGRVAQVGERIEPGDELRIDGRKVQFQIE
DEIRRRVLIYYKPEGEICSRNDPESRPTVFDHLPTIANDRWVMVGRLDINSTGLLLFTND
GELANRLMHPSNEIEREYAVRVMGEVTPQIRQNMLNGVVLDDGPAKFESFSEIGGDGINR
WYQVVVKEGRNREVRRIFESQGLKVSRLLRTRYGTVILPRELRTGRWIELDKADIDNLTK
SVELKPRQGTGLYGMAKRRTERMAEKPMAARRGGYLRQQRRENEGTEQTAAPRKPYSPKK
F