Protein Info for MPMX26_02413 in Acinetobacter radioresistens SK82

Annotation: Acetylglutamate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 PF00696: AA_kinase" amino acids 29 to 274 (246 residues), 160 bits, see alignment E=4.1e-51 TIGR00761: acetylglutamate kinase" amino acids 30 to 272 (243 residues), 267.9 bits, see alignment E=3.6e-84

Best Hits

Swiss-Prot: 89% identical to ARGB_ACIBC: Acetylglutamate kinase (argB) from Acinetobacter baumannii (strain ACICU)

KEGG orthology group: K00930, acetylglutamate/acetylaminoadipate kinase [EC: 2.7.2.- 2.7.2.8] (inferred from 90% identity to acd:AOLE_15270)

Predicted SEED Role

"Acetylglutamate kinase (EC 2.7.2.8)" in subsystem Arginine Biosynthesis extended (EC 2.7.2.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.2.- or 2.7.2.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (306 amino acids)

>MPMX26_02413 Acetylglutamate kinase (Acinetobacter radioresistens SK82)
MPHQQTSAGINKAEILTEALPYIQHFAGKTLVVKYGGNAMTDPALESSFARDIVLLKTVG
LNPVVVHGGGPQVDSFLKQLGRESERIDGMRVTDPATMEVVEMVLGGSVNKSIVNLINQH
GGRAIGLTGKDGNLLKARKLLMEKQAEDGSIHQIDLGLVGEVVEVKTDVIEMFTQSDFIP
VIAPLGVDEEGNTYNINADLVAGKVAEALGAEKLVLLTNIAGVLDENKKLLTGLTTQEVD
HLIETGVIYGGMIPKVGCALDAVKAGVVSAHIVDGRVPHATLLEVFTDHGVGTLITNRAH
FGASRS