Protein Info for MPMX26_02409 in Acinetobacter radioresistens SK82

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 107 PF03658: Ub-RnfH" amino acids 6 to 86 (81 residues), 89.6 bits, see alignment E=6.9e-30

Best Hits

Swiss-Prot: 51% identical to RNFH_ESCF3: Protein RnfH (rnfH) from Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73)

KEGG orthology group: K09801, hypothetical protein (inferred from 65% identity to aby:ABAYE2922)

Predicted SEED Role

"UPF0125 protein yfjF"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (107 amino acids)

>MPMX26_02409 hypothetical protein (Acinetobacter radioresistens SK82)
MVKHQQVWVAYAHPEAQFLIAVEFTEGMTVRDAIEQSGIRNKIDLPEVLQTGIFGIKVTE
MSQPLQAGDRVEIYRPLTVNPKETRRKRAEKNPVGRYAKSNRLRQLK