Protein Info for MPMX26_02404 in Acinetobacter radioresistens SK82

Annotation: Pyridoxal phosphate homeostasis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 231 TIGR00044: pyridoxal phosphate enzyme, YggS family" amino acids 1 to 225 (225 residues), 246.4 bits, see alignment E=1.3e-77 PF01168: Ala_racemase_N" amino acids 12 to 225 (214 residues), 83.5 bits, see alignment E=9.2e-28

Best Hits

Swiss-Prot: 50% identical to PLPHP_ECO57: Pyridoxal phosphate homeostasis protein (yggS) from Escherichia coli O157:H7

KEGG orthology group: K06997, (no description) (inferred from 75% identity to abc:ACICU_00849)

Predicted SEED Role

"Hypothetical protein YggS, proline synthase co-transcribed bacterial homolog PROSC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (231 amino acids)

>MPMX26_02404 Pyridoxal phosphate homeostasis protein (Acinetobacter radioresistens SK82)
MNKLQDARDQVLAQIREASHKAGRADETVQLLAVSKTHSAGVLREMYQAGQRSFGENYLQ
EALEKIHSLQDLNDIEWHFIGHVQRNKTKLLAENFDWVHGVDRLIIAERLSAQRPEQRAA
LNICIQVNIDGQESKDGCTPEQVAELVKMISQLPNLCLRGLMVIPAPGHTDAFEHTRQLF
NQVRTFHAHPQVWDTLSMGMSADLEAAVVAGSTMVRIGTALFGTRDYSDKV