Protein Info for MPMX26_02325 in Acinetobacter radioresistens SK82

Annotation: Sulfate adenylyltransferase subunit 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00009: GTP_EFTU
  • amino acids 23 to 226 (204 residues), 165.9 bits, E=7.9e-53
• TIGR02034: sulfate adenylyltransferase, large subunit
  • amino acids 25 to 433 (409 residues), 657 bits, E=1.1e-201
• TIGR00231: small GTP-binding protein domain
  • amino acids 31 to 212 (182 residues), 51.6 bits, E=9.4e-18
• PF01926: MMR_HSR1
  • amino acids 84 to 166 (83 residues), 24.5 bits, E=2.5e-09

Best Hits

Swiss-Prot: 67% identical to CYSN_TERTT: Sulfate adenylyltransferase subunit 1 (cysN) from Teredinibacter turnerae (strain ATCC 39867 / T7901)

KEGG orthology group: K00956, sulfate adenylyltransferase subunit 1 [EC: 2.7.7.4] (inferred from 84% identity to aby:ABAYE2790)

Predicted SEED Role

"Sulfate adenylyltransferase subunit 1 (EC 2.7.7.4)" in subsystem Cysteine Biosynthesis (EC 2.7.7.4)

MetaCyc Pathways

• superpathway of L-methionine biosynthesis (by sulfhydrylation) (11/12 steps found)
• superpathway of sulfate assimilation and cysteine biosynthesis (8/9 steps found)
• assimilatory sulfate reduction III (3/3 steps found)
• assimilatory sulfate reduction I (3/4 steps found)
• assimilatory sulfate reduction IV (3/4 steps found)
• assimilatory sulfate reduction II (2/3 steps found)
• sulfate activation for sulfonation (1/2 steps found)
• sulfite oxidation III (1/3 steps found)
• superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (6/10 steps found)
• selenate reduction (2/5 steps found)
• dissimilatory sulfate reduction I (to hydrogen sufide)) (1/5 steps found)
• superpathway of sulfur metabolism (Desulfocapsa sulfoexigens) (1/6 steps found)
• superpathway of thiosulfate metabolism (Desulfovibrio sulfodismutans) (1/6 steps found)
• superpathway of sulfide oxidation (phototrophic sulfur bacteria) (2/12 steps found)
• superpathway of seleno-compound metabolism (6/19 steps found)

KEGG Metabolic Maps

• Purine metabolism
• Selenoamino acid metabolism
• Sulfur metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.4

Use Curated BLAST to search for 2.7.7.4

Protein Sequence (537 amino acids)

>MPMX26_02325 Sulfate adenylyltransferase subunit 1 (Acinetobacter radioresistens SK82)
MSHQSELISQDILAYLKQHEQKDLLRFLTCGNVDDGKSTLIGRLLFDSKLIYEDQLQAVT
RDSKKVGTTGDAPDLALLVDGLQAEREQGITIDVAYRYFSTEKRKFIIADTPGHEQYTRN
MATGASTCDLAIILIDARYGVQTQTRRHSYIASLLGIKNIIVAINKMDLVDFSEARFNEI
QAEYNDFVNQLGDRKPANIIFTPISALNGDNVVNPSANTPWYKGQTLMATLENVEINRNS
AKQEFRFPVQYVNRPNLDFRGFAGTIALGTVNVGDEIIALPSGKRSTVKEIVTYDGNLEQ
AVAGQAVTLTLNDEIDISRGNLIVKAGDQPEISRSVRATVVWMTDQPLVKGKLYNIKLGT
QTVPAKVTEINYRVNVNTLEQTQVEQLELNAIANVTVEFDAPVVFDRYQDSRYTGAFIFI
DRLSNVTVGAGMVESAVEWNANGKPVTAEDRAARLGQKPAVVSVNTQVLEHAQGLESLLM
QQGIVALAKVGLTAEQAILLRETGIVVITDITEGADVKLNLDTVEDLADKIVELVRL