Protein Info for MPMX26_02319 in Acinetobacter radioresistens SK82

Annotation: Isocitrate lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 534 PF00463: ICL" amino acids 98 to 270 (173 residues), 85.5 bits, see alignment E=3.2e-28 amino acids 317 to 396 (80 residues), 43.9 bits, see alignment E=1.3e-15 amino acids 443 to 522 (80 residues), 38.7 bits, see alignment E=4.8e-14 PF13714: PEP_mutase" amino acids 163 to 263 (101 residues), 40 bits, see alignment E=3.4e-14

Best Hits

Swiss-Prot: 74% identical to ACEA_PSEAE: Isocitrate lyase (PA2634) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01637, isocitrate lyase [EC: 4.1.3.1] (inferred from 96% identity to abc:ACICU_00968)

Predicted SEED Role

"Isocitrate lyase (EC 4.1.3.1)" in subsystem Serine-glyoxylate cycle (EC 4.1.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (534 amino acids)

>MPMX26_02319 Isocitrate lyase (Acinetobacter radioresistens SK82)
MTTYQTAIDAVRELKAKFGDTWRDISPEDAARMQLQNRFKTGLDIAKYTAAIMRRDMAAY
DADSSKYTQSLGCWHGFIAQQKMIANKKYFGTTERRYIYLSGWMVAALRSEFGPLPDQSM
HEKTSVPALIEEIYTFLRQADAKELNDLFRALNKAKEAGDSAKVAEITSQIDNFETHVVP
IIADIDAGFGNEEATYLLAKKMIEAGACALQIENQVSDAKQCGHQAGKVTVPHEDFIAKI
HALRYAFLEMGLEDGIIVARTDSEGADLTQKIPVVKEPGDIASQYISYLDTTEIDISEAQ
EDEILIKRDGKLHRPKRLASGLYQFREGTQIDRVVLDCVTSLQNGADLLWIETATPNVEE
IAHMVNRVKEVVPNAKLVYNNSPSFNWTLNFRQQAYDRWVAEGKDVSAYDRAKLMSAEYD
DSELAAEADAKIRTFQADASREAGVFHHLITLPTYHTAALSTHELAQGYFGSEGMLAYVA
GVQRKEIRGGIACVKHQAMAGSDIGDDHKEIFAGDNALKAGDDAKNTMNQFANH