Protein Info for MPMX26_02306 in Acinetobacter radioresistens SK82

Annotation: Endonuclease III

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 238 TIGR01083: endonuclease III" amino acids 15 to 205 (191 residues), 284.5 bits, see alignment E=1.8e-89 PF00730: HhH-GPD" amino acids 45 to 180 (136 residues), 77.8 bits, see alignment E=1.2e-25 PF00633: HHH" amino acids 111 to 138 (28 residues), 35.9 bits, see alignment (E = 6.6e-13) PF10576: EndIII_4Fe-2S" amino acids 198 to 214 (17 residues), 21.3 bits, see alignment (E = 4e-08)

Best Hits

Swiss-Prot: 74% identical to END3_ECOL6: Endonuclease III (nth) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K10773, endonuclease III [EC: 4.2.99.18] (inferred from 84% identity to aci:ACIAD1108)

MetaCyc: 74% identical to endonuclease III (Escherichia coli K-12 substr. MG1655)
DNA-(apurinic or apyrimidinic site) lyase. [EC: 4.2.99.18]; 4.2.99.18 [EC: 4.2.99.18]; 4.2.99.18 [EC: 4.2.99.18]

Predicted SEED Role

"Endonuclease III (EC 4.2.99.18)" in subsystem Control of cell elongation - division cycle in Bacilli or DNA Repair Base Excision (EC 4.2.99.18)

Isozymes

Compare fitness of predicted isozymes for: 4.2.99.18

Use Curated BLAST to search for 4.2.99.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (238 amino acids)

>MPMX26_02306 Endonuclease III (Acinetobacter radioresistens SK82)
MSTVTSKPVKKMNKKQVYTFFERLRQQRPHPTTELRFSSPFELLVAVTLSAQATDVSVNK
ATDKLFPVANTPEAIYALGVEGLKAYIKTIGLYNAKAENVIKACKILIEQHNGQVPETRA
ELEALPGVGRKTANVVLNTAFGQPTMAVDTHIFRVGNRTGLAPGKNVLEVEQQLLKVIPK
EFIVDAHHWLILHGRYTCIARKPKCFECVVADVCNWPDRYALGAEQAITTLIPQLSDK