Protein Info for MPMX26_02269 in Acinetobacter radioresistens SK82

Annotation: NADPH dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 414 PF00724: Oxidored_FMN" amino acids 6 to 338 (333 residues), 192.7 bits, see alignment E=5.4e-61

Best Hits

KEGG orthology group: None (inferred from 84% identity to aci:ACIAD1143)

MetaCyc: 44% identical to mupirocin C dehydrogenase (Pseudomonas fluorescens NCIMB 10586)
1.1.1.M50 [EC: 1.1.1.M50]; 1.1.1.M50 [EC: 1.1.1.M50]

Predicted SEED Role

"2,4-dienoyl-CoA reductase [NADPH] (EC 1.3.1.34)" (EC 1.3.1.34)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.3.1.34

Use Curated BLAST to search for 1.1.1.M50 or 1.3.1.34

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (414 amino acids)

>MPMX26_02269 NADPH dehydrogenase (Acinetobacter radioresistens SK82)
MSLIAEPITIRNTTFKNRIIKGAMSEALANAAGQPNHLHYGLYEAWAKGGLGCAITGNVM
VDIGAKNEPGVVAIESERDLEQLKHWAEIGKEYGMVQLVQLSHPGRQCPKGLNKETVAPS
AVPFSPVLATTFGTPRELREEEILDIIQRFAHAAKICEKAGFEGIQLHGAHGYLISQFLS
PLTNKRQDQWGGSIENRMRFLLEIYKAVRAGTSENFIISVKLNSADFQRGGITEEDVIYV
FKAIDAAGIDLIEISGGSYEAPAMAGVKEGKRKASTIAREAYFLDFSEKIRQEVKCHLMV
TGGFRTVKGMNDALESGACDFIGIARPFAVETDLSNHLIAGKDVRYGVEKIKTGIPMIDK
MAIMEIIWYAAQFKAIAEGKKPNPKLSPLKVFFKYLKGNLTAVVKGQINSRKSA