Protein Info for MPMX26_02261 in Acinetobacter radioresistens SK82

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 419 transmembrane" amino acids 55 to 76 (22 residues), see Phobius details amino acids 83 to 107 (25 residues), see Phobius details amino acids 117 to 140 (24 residues), see Phobius details amino acids 146 to 163 (18 residues), see Phobius details amino acids 170 to 190 (21 residues), see Phobius details amino acids 196 to 216 (21 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 245 to 411 (167 residues), 174 bits, see alignment E=1.1e-55 PF00990: GGDEF" amino acids 248 to 407 (160 residues), 171 bits, see alignment E=8.9e-55

Best Hits

KEGG orthology group: None (inferred from 57% identity to acd:AOLE_14015)

Predicted SEED Role

"Phytochrome-like protein; Cph2"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (419 amino acids)

>MPMX26_02261 hypothetical protein (Acinetobacter radioresistens SK82)
MEYKYYLTTLQQQKEKIETLVALHSHCTSSSLPQALEQEFWQQNTERARINISQSFAAGV
WAYLLFTALVLPGDYWLSGQRFFSADFLLCIVAMLNGAVSLLTLYGFARSKLLQPYFYQA
ALGLMLWTIISSCLLSMSFATPALKYQSAIVLCFIYMLGFMISGVRPLHMLLVGTLAAVI
SIYLLFVFHISFEVIILSRVLLGSCLFGFTLSTMLIKRERILFLNTKLAQLNEKIQYIHA
SELLHLSQHDELTQISNRRNFDETLDSFYRQSRKEGTPLSLLFIDVDFFKNYNDFYGHQM
GDKVIYSIARAIKNSIRHRDFVARYGGEEFVVLLPETEAHGAYAVASNIYREIERLAIPH
ERSCIASYITVSLGITIYRGEAAVTQEALLESADQALYRAKQLGRNQIFYQSVGSTKVA