Protein Info for MPMX26_02259 in Acinetobacter radioresistens SK82

Annotation: L-lactate permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 555 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 42 to 60 (19 residues), see Phobius details amino acids 69 to 92 (24 residues), see Phobius details amino acids 120 to 148 (29 residues), see Phobius details amino acids 155 to 180 (26 residues), see Phobius details amino acids 200 to 218 (19 residues), see Phobius details amino acids 225 to 241 (17 residues), see Phobius details amino acids 253 to 270 (18 residues), see Phobius details amino acids 303 to 322 (20 residues), see Phobius details amino acids 372 to 391 (20 residues), see Phobius details amino acids 412 to 432 (21 residues), see Phobius details amino acids 434 to 440 (7 residues), see Phobius details amino acids 443 to 462 (20 residues), see Phobius details amino acids 533 to 554 (22 residues), see Phobius details TIGR00795: transporter, lactate permease (LctP) family" amino acids 7 to 548 (542 residues), 743.1 bits, see alignment E=1e-227 PF02652: Lactate_perm" amino acids 18 to 546 (529 residues), 724.9 bits, see alignment E=3.1e-222

Best Hits

Swiss-Prot: 74% identical to LLDP_SALTY: L-lactate permease (lldP) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K00427, L-lactate permease (inferred from 75% identity to sml:Smlt2910)

Predicted SEED Role

"L-lactate permease" in subsystem Lactate utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (555 amino acids)

>MPMX26_02259 L-lactate permease (Acinetobacter radioresistens SK82)
MLSQWQQIYDPMGNLWISSLVALIPIIFFFLALAVFRLKGSVAGTITVVLALLVSLFAYG
MPTDMAFASVIYGFFYGLWPISWIIIGAVFLYKVSVKTGQFDIIRSSILSITEDQRLQML
LVGFAFGTFLEGAAGFGAPVAITAALLVGLGFKPLYAAGLCLIVNTAPVAFGAMGIPIIV
AGQVSGVDTMEISQMVGRQLPFMVPIVLFWIMAIMDGWRGIKETWPAVIVAGGAFSLAQY
LTSNFVGPELPDITAAIASLVSLTILLKYWKPKHIFRFKDENDSQVDAELLASQKQKFSI
GQIAKAWSPFVILTAMVTLWSIKPFKDLFAKDGPMQDWVISIKVPYLHQLVQKVPPVVPE
VKDYDAIFKFDWLSATGTAIIIAALITIVYLKMKPREALVTFGETVNELKTPIYSIGMVL
AFAFIANYSGMSATLALALAHTGNAFTFFSPFLGWLGVFLTGSDTSANALFAALQATTAQ
QIGVPEVLLVAANTSGGVTGKMISPQSIAIACAAAGLVGKESDLFRFTVKHSITFTVMIG
IIITLQAYVFPWMIP