Protein Info for MPMX26_02232 in Acinetobacter radioresistens SK82

Annotation: Diaminopimelate decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 416 TIGR01048: diaminopimelate decarboxylase" amino acids 7 to 410 (404 residues), 534.7 bits, see alignment E=5.8e-165 PF00278: Orn_DAP_Arg_deC" amino acids 29 to 368 (340 residues), 83.1 bits, see alignment E=2.1e-27 PF01168: Ala_racemase_N" amino acids 34 to 233 (200 residues), 24.9 bits, see alignment E=2.3e-09 PF02784: Orn_Arg_deC_N" amino acids 36 to 279 (244 residues), 244.1 bits, see alignment E=2.2e-76

Best Hits

Swiss-Prot: 60% identical to DCDA_VIBCH: Diaminopimelate decarboxylase (lysA) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K01586, diaminopimelate decarboxylase [EC: 4.1.1.20] (inferred from 86% identity to acd:AOLE_04145)

Predicted SEED Role

"Diaminopimelate decarboxylase (EC 4.1.1.20)" in subsystem Lysine Biosynthesis DAP Pathway (EC 4.1.1.20)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (416 amino acids)

>MPMX26_02232 Diaminopimelate decarboxylase (Acinetobacter radioresistens SK82)
MSFTRINGVLHAEQCSLKQLAQQFGTPLYVYSKQAFEKHYTDMDRAFNFIDHQICFAVKS
NSNLAVLGVLAKLGAGFDIVTGGELARVLAAGGDPAKVVFSGLGKTEIDIEKALNVGIAC
FNVESHAELDRIQKVAKKLGQKAPVSLRVNPDVDAKTHPYISTGLKENKFGIPSDSVFET
YQYAASLPNLNIVGIDCHIGSQLTETKPFVDALERVMLMIEQLNELGIQLKHIDIGGGLG
VTYKDEVPPTVQEYADALKPALQKLGLKVYMEPGRSISANAGILLTRVDLLKPTNHRNFA
IIDAAMNDLIRPALYEAWMDIQPVEPHQDIQEKEWDIVGAICETGDFLGKERKLALAEND
LLAVLGAGAYGFVMSSNYNTRARAAEVMVNNHQAYLVRERETIESLWEREHLLPEV