Protein Info for MPMX26_02230 in Acinetobacter radioresistens SK82

Annotation: Tyrosine recombinase XerC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 PF13495: Phage_int_SAM_4" amino acids 8 to 89 (82 residues), 36.2 bits, see alignment E=9.7e-13 PF02899: Phage_int_SAM_1" amino acids 18 to 88 (71 residues), 57.1 bits, see alignment E=2.7e-19 PF00589: Phage_integrase" amino acids 117 to 289 (173 residues), 150.2 bits, see alignment E=7.7e-48

Best Hits

Swiss-Prot: 48% identical to XERC_HISS2: Tyrosine recombinase XerC (xerC) from Histophilus somni (strain 2336)

KEGG orthology group: K03733, integrase/recombinase XerC (inferred from 79% identity to abc:ACICU_02872)

Predicted SEED Role

"Tyrosine recombinase XerC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (306 amino acids)

>MPMX26_02230 Tyrosine recombinase XerC (Acinetobacter radioresistens SK82)
MQPEALHLLSMWLKEREIQNQSAHTLSAYARDVKDFLDFCAVKKLPLNSIEASDLREYLA
LKVEREQLSSSSLQRHLSAIRQFMKWAEQGQYLGFNPADDFQLKRQPRPLPGMIDIETVQ
QILDQPAPEKLQDQHLWLRDKAMLELLYSSGLRLTELQSLCMKDIDFNRRLLRITGKGNK
TRIVPFGTQAYESLLKWLEVYRLWQGQFNADSAVFISQKGGQLGPRQIENRVKLQALRAG
VNIDLHPHLLRHCFASHMLSNSGDLRAVQEMLGHSNLSTTQIYTHIDFDHLAKIYDQAHP
RAVKIK