Protein Info for MPMX26_02205 in Acinetobacter radioresistens SK82

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 395 transmembrane" amino acids 7 to 25 (19 residues), see Phobius details amino acids 30 to 50 (21 residues), see Phobius details amino acids 57 to 79 (23 residues), see Phobius details amino acids 154 to 174 (21 residues), see Phobius details amino acids 214 to 243 (30 residues), see Phobius details amino acids 245 to 267 (23 residues), see Phobius details amino acids 276 to 295 (20 residues), see Phobius details amino acids 310 to 340 (31 residues), see Phobius details PF01594: AI-2E_transport" amino acids 10 to 343 (334 residues), 201.9 bits, see alignment E=8.1e-64

Best Hits

KEGG orthology group: None (inferred from 81% identity to aci:ACIAD2633)

Predicted SEED Role

"Putative permease often clustered with de novo purine synthesis" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (395 amino acids)

>MPMX26_02205 hypothetical protein (Acinetobacter radioresistens SK82)
MVDRTLRRIFILAAIALLLWVLYLLKPVVIPFLMAFLIAYLFSPLVAWLHKYHLPRWLSI
SIVFIGIGILLVLAIWYVVPLVWQQLVYARDSIPAGIHWLNATFLPWVSNTFNVEQMEID
TEQISTVVMDYIQTNYSADSIQTMLLRLAQSGLNFIQIGGTIVLIPIIAFYFLLDWDRML
NSMRRLIPRPYEKNTIQVVHECHNVLGAFVKGQFLVMILLGIVYAVGLQLIGLEVGLIIG
MVAGLASIIPYLGFAVGIIAAVIATLFQFGLDWTQLILVGVVFMVGQAVEGYILQPFLLG
DKIGLSPVAVVFAVLAGAQLAGFFGMLIALPMAAVIVVLLRHLRECYEHSTFYGPPNLMG
DKGTDSLIIDAEQVNLDIEIEKSQDTEKTVHIDTK