Protein Info for MPMX26_02199 in Acinetobacter radioresistens SK82

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 213 PF07638: Sigma70_ECF" amino acids 30 to 192 (163 residues), 24.6 bits, see alignment E=5.4e-09 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 49 to 200 (152 residues), 76.8 bits, see alignment E=7.4e-26 PF04542: Sigma70_r2" amino acids 54 to 103 (50 residues), 24.7 bits, see alignment E=4.2e-09 PF08281: Sigma70_r4_2" amino acids 144 to 193 (50 residues), 55.8 bits, see alignment E=6.9e-19 PF04545: Sigma70_r4" amino acids 150 to 197 (48 residues), 29.4 bits, see alignment 1.2e-10 PF22233: PhyR_sigma-like" amino acids 152 to 194 (43 residues), 31.1 bits, see alignment 4e-11

Best Hits

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 82% identity to aci:ACIAD2627)

Predicted SEED Role

"putative RNA polymerase sigma factor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (213 amino acids)

>MPMX26_02199 hypothetical protein (Acinetobacter radioresistens SK82)
MTGFSISMDLVPKQPDAEHLSSTHASTAEQRLKFFMQDVTGRALVMMESATHGQQGIAMD
LVQEAFISLHKSYRDKSTEEWYPLFYTILNNKLQDWRRKEARRAQPFSFFRKVSLDSDEE
EMMDIVDESSPNPSDFLDQAVTAEEIQAAVSKLPVRQQQAFMLRAWEGFDTQTTAEIMDC
TEGSVKTHYHRAIQGLRTALAHLNPHMGGSSDE