Protein Info for MPMX26_02197 in Acinetobacter radioresistens SK82

Annotation: Fructose-1,6-bisphosphatase class 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00316: FBPase
  • amino acids 11 to 185 (175 residues), 187.1 bits, E=2.7e-59
• PF18913: FBPase_C
  • amino acids 191 to 323 (133 residues), 147.6 bits, E=1.7e-47

Best Hits

Swiss-Prot: 88% identical to F16PA_ACIBC: Fructose-1,6-bisphosphatase class 1 (fbp) from Acinetobacter baumannii (strain ACICU)

KEGG orthology group: K03841, fructose-1,6-bisphosphatase I [EC: 3.1.3.11] (inferred from 89% identity to acd:AOLE_04340)

Predicted SEED Role

"Fructose-1,6-bisphosphatase, type I (EC 3.1.3.11)" in subsystem Calvin-Benson cycle or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes (EC 3.1.3.11)

MetaCyc Pathways

• gluconeogenesis I (12/13 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (10/12 steps found)
• gluconeogenesis III (10/12 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (20/26 steps found)
• Calvin-Benson-Bassham cycle (10/13 steps found)
• sucrose biosynthesis I (from photosynthesis) (7/9 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (19/26 steps found)
• glycolysis II (from fructose 6-phosphate) (8/11 steps found)
• ethene biosynthesis V (engineered) (18/25 steps found)
• glycolysis I (from glucose 6-phosphate) (9/13 steps found)
• superpathway of anaerobic sucrose degradation (13/19 steps found)
• oxygenic photosynthesis (11/17 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (18/27 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (12/19 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (9/17 steps found)
• superpathway of N-acetylneuraminate degradation (12/22 steps found)
• superpathway of hexitol degradation (bacteria) (9/18 steps found)

KEGG Metabolic Maps

• Biosynthesis of phenylpropanoids
• Carbon fixation in photosynthetic organisms
• Fructose and mannose metabolism
• Glycolysis / Gluconeogenesis
• Pentose phosphate pathway

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.11

Protein Sequence (324 amino acids)

>MPMX26_02197 Fructose-1,6-bisphosphatase class 1 (Acinetobacter radioresistens SK82)
MTNYTLSQYLQQQTGNLTPELAQVISTIADTCKVIDQTLQKGALAGVLGSAEHENVQGET
QKKLDVISNDYLIDALKVHPQVGGLASEELDEFTPAQENGQYLVLFDPLDGSSNIDINMC
VGTIFSILPAKNHVTQAADFMQAGTQQVAAGYVLYGPSTMLVLTVGAGVVFFTFNPDSQE
FVLTAENIQVAADTQEFAINASNQRHWEEPVKRYIDELLAGKTSTRAKDFNMRWVACMVG
DIHRILCRSGIFLYPYDLKDPKKAGRLRLMYEANPMSMLIEQAGGASTTGRVRILEIEPT
DLHQRVPVIIGSKNEVELVTGYHQ