Protein Info for MPMX26_02195 in Acinetobacter radioresistens SK82

Annotation: Peptidoglycan-associated lipoprotein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02802: peptidoglycan-associated lipoprotein
  • amino acids 80 to 182 (103 residues), 147 bits, E=8.6e-48
• PF00691: OmpA
  • amino acids 81 to 175 (95 residues), 85 bits, E=2e-28

Best Hits

KEGG orthology group: K03640, peptidoglycan-associated lipoprotein (inferred from 83% identity to aci:ACIAD2623)

Predicted SEED Role

"18K peptidoglycan-associated outer membrane lipoprotein; Peptidoglycan-associated lipoprotein precursor; Outer membrane protein P6; OmpA/MotB precursor"

Protein Sequence (190 amino acids)

>MPMX26_02195 Peptidoglycan-associated lipoprotein (Acinetobacter radioresistens SK82)
MNAVKYLTLPLLAASLVITGCANRKPTSDVTTTTTPTTAGTSVNTTGLSEDAALNAQNMA
GASAKGVTAANRAYLAKRVVYFDYDSSDLSNEDYQTLQAHAQFLMANANSKVALTGHTDE
RGTREYNMALGERRAKAVQSYLVTNGVNPNQLEAVSYGKEMPINPGHDEAAWKENRRVEI
NYEAVPPLLK