Protein Info for MPMX26_02171 in Acinetobacter radioresistens SK82
Annotation: HTH-type transcriptional regulator SsuR
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 56% identical to SSUR_BURCJ: HTH-type transcriptional regulator SsuR (ssuR) from Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
KEGG orthology group: K13635, LysR family transcriptional regulator, cys regulon transcriptional activator (inferred from 91% identity to aby:ABAYE0925)MetaCyc: 44% identical to DNA-binding transcriptional dual regulator CysB (Escherichia coli K-12 substr. MG1655)
Predicted SEED Role
"Alkanesulfonate utilization operon LysR-family regulator CbI" in subsystem DNA-binding regulatory proteins, strays
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (307 amino acids)
>MPMX26_02171 HTH-type transcriptional regulator SsuR (Acinetobacter radioresistens SK82) MNFQQLRIIRETVRQNFNLTEASAALYTSQSGVSKHIKDLEDELGVQLFIRKGKRLLGLT EPGQSLLNIVERMLVDAENIKRLADDFNKVDEGTLTIATTHTQARYVLPPIVNQFKKAFP KVHLILQQASPVEISEMLLQGEADIGIATESLTTEENLASVPYYTWEHSIITPQHHPLTQ LENIRLEDLANYPIITYHGGFTGRSKIDKAFEAANIEVDIVMSALDADVIKTYVELGMGV GIVNNVAYDAERDYRLKQIQTDIFGLNTTWLAVRKGHLLRGYGYEFISLCSPEADIKALK KVAYPEE