Protein Info for MPMX26_02164 in Acinetobacter radioresistens SK82

Annotation: Endolytic murein transglycosylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 347 transmembrane" amino acids 19 to 40 (22 residues), see Phobius details TIGR00247: conserved hypothetical protein, YceG family" amino acids 20 to 345 (326 residues), 289.8 bits, see alignment E=1.3e-90 PF02618: YceG" amino acids 53 to 338 (286 residues), 278.7 bits, see alignment E=2.8e-87

Best Hits

KEGG orthology group: K07082, UPF0755 protein (inferred from 74% identity to abm:ABSDF0942)

Predicted SEED Role

"FIG004453: protein YceG like"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (347 amino acids)

>MPMX26_02164 Endolytic murein transglycosylase (Acinetobacter radioresistens SK82)
MPKLHSTPKKKNAKPTFPAVLTIIAGLFILGLVVLWSSLFKNYPVNGPKQMLAINPGDTY
SGFIDRLAEDDKISFPIILKLYQKLVIHDTLKAGVYEIQKGMSVRQVLELISNAENAQMN
RILVIEGTTFKQLLENLKKDQLVTHTITHLPEQQLLKELNIPYSHPEGLFSPDTYFFAKG
ETDRKILTHLYTRQMKALDEAWQNRASGLPYKDKYEALIMASIIEKETSIDSELQQVSGV
FVRRLKMGMRLQTDPTVIYGMGDNYKGNITRKDLRTPTPYNTYTISGLPPTPIALPSKKA
IEAAMHPDNSNNIYFVATGNGGHKFSASLEEHNRAVQQYLSVLRAKN