Protein Info for MPMX26_02161 in Acinetobacter radioresistens SK82

Annotation: Periplasmic pH-dependent serine endoprotease DegQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 460 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details TIGR02037: peptidase Do" amino acids 29 to 453 (425 residues), 458 bits, see alignment E=1.7e-141 PF13365: Trypsin_2" amino acids 87 to 220 (134 residues), 124.5 bits, see alignment E=2.1e-39 PF00089: Trypsin" amino acids 88 to 241 (154 residues), 53.5 bits, see alignment E=1.1e-17 PF00595: PDZ" amino acids 257 to 337 (81 residues), 39.3 bits, see alignment E=2.4e-13 amino acids 372 to 435 (64 residues), 32.9 bits, see alignment E=2.5e-11 PF13180: PDZ_2" amino acids 260 to 349 (90 residues), 61.4 bits, see alignment E=2.9e-20 amino acids 370 to 452 (83 residues), 36.3 bits, see alignment E=1.9e-12 PF17820: PDZ_6" amino acids 286 to 339 (54 residues), 57.6 bits, see alignment 2.9e-19 PF12812: PDZ_1" amino acids 371 to 439 (69 residues), 28.1 bits, see alignment E=5.8e-10

Best Hits

KEGG orthology group: K01362, [EC: 3.4.21.-] (inferred from 79% identity to aci:ACIAD2586)

Predicted SEED Role

"Serine protease precursor MucD/AlgY associated with sigma factor RpoE" in subsystem Transcription initiation, bacterial sigma factors

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.-

Use Curated BLAST to search for 3.4.21.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (460 amino acids)

>MPMX26_02161 Periplasmic pH-dependent serine endoprotease DegQ (Acinetobacter radioresistens SK82)
MKNRLLQKGMYAAVFTMAAVQTQAASTVDFSNLVEQVSPAVVSVNVVKKMTQEELLQQQV
PELLRRFFGNQVIIPQQQVPQEKTGYGSAFFISKDGYLLTNHHVVENASRISITLNDRRE
IDATVVGSDERTDVALLKVNGSSFPALRIGNVDQLKVGEPVLAIGSPFGFDYSASAGIVS
AKSRSMMGETSVPFIQTDVALNPGNSGGPLFNQRGEVVGVNSRIFSGTGGYMGLSFSIPI
DVAMDVAEQLKSNGKVIRSYLGVMLQDIDRNLAEAYKLPKPEGSLITQVAPNSPAARAGL
KAGDIILQINGMAISRTSDLLNYLNRQAPNQSIRLQVLRDEKLSNITATLTTAPDNTPAK
TNTPVQNKGPVLGIAIRNLTEAESRQLGVDGGVYIQEVMRGGLAAQSRLMPEDIITQINN
TPVRNSDEFVNAVSKLKKNTVARVALIRQGQRAILGLRIQ