Protein Info for MPMX26_02158 in Acinetobacter radioresistens SK82

Annotation: Signal peptidase I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 275 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 41 to 62 (22 residues), see Phobius details PF10502: Peptidase_S26" amino acids 42 to 256 (215 residues), 182.4 bits, see alignment E=3.5e-58 TIGR02227: signal peptidase I" amino acids 49 to 257 (209 residues), 165.4 bits, see alignment E=4.9e-53

Best Hits

KEGG orthology group: K03100, signal peptidase I [EC: 3.4.21.89] (inferred from 88% identity to aci:ACIAD2583)

Predicted SEED Role

"Signal peptidase I (EC 3.4.21.89)" in subsystem Signal peptidase (EC 3.4.21.89)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.21.89

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (275 amino acids)

>MPMX26_02158 Signal peptidase I (Acinetobacter radioresistens SK82)
MDFDFNLILVPVTVIFFLVWLLDKLVFKQRKTRGRGNENFIITWAYDFWPVLAIVLVLRS
FFYEPFNIPSDSMVPTLETGDFILVNKYQYGMRLPIINKKFIDIGEPERGDVVVFRYPPQ
PSISYIKRVVGLPGDHIVYDHGQLSINGQPVKKVPVEFSREKDIQDTPASIYHKETLGKH
TFTMRELEGVNVARQAPFINYVENGKYSGEDGLYWEVKVPEGHYFAMGDNRDQSADSRFW
GFVPEENLAGRAVYIWMHKEPGFKIPSFARNGKID