Protein Info for MPMX26_02130 in Acinetobacter radioresistens SK82

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 508 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 47 to 69 (23 residues), see Phobius details amino acids 81 to 100 (20 residues), see Phobius details amino acids 121 to 142 (22 residues), see Phobius details amino acids 154 to 173 (20 residues), see Phobius details amino acids 185 to 207 (23 residues), see Phobius details amino acids 214 to 232 (19 residues), see Phobius details PF03741: TerC" amino acids 15 to 204 (190 residues), 159.2 bits, see alignment E=1.3e-50 PF00571: CBS" amino acids 366 to 414 (49 residues), 20.3 bits, see alignment 8.9e-08 PF03471: CorC_HlyC" amino acids 428 to 507 (80 residues), 49.4 bits, see alignment E=5.8e-17

Best Hits

KEGG orthology group: None (inferred from 76% identity to aci:ACIAD2331)

Predicted SEED Role

"Magnesium and cobalt efflux protein CorC" in subsystem Copper homeostasis: copper tolerance or Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (508 amino acids)

>MPMX26_02130 hypothetical protein (Acinetobacter radioresistens SK82)
MEFLLDPGIWVGLLTLIVLEIVLGIDNLVFIAILADKLPPEKRDKARVIGLSLALVMRLG
LLFAISWLVTLTQPLITVFDWTFSGRDLILLFGGLFLLYKAVSELHERMEGKTEVKVTTN
VAYASFTAVVAQIVILDAVFSLDSVITAIGMVDNIYVMMAAMIVAMAVMLLASKPLTEFV
NRHPTVIILCLSFLLLIGISLIAEGFGFHIPKGYIYSGIGVAILIEIFNQFTSRNAAKHE
AKIPLRHRTANSILKLMGGRVETVADAQSTEAQDAFVDEERYMIGGVLTLAERSVASIMT
PRNQISWVNLEDSPEQIREQVLSVPHSLFPVCRGSLDKVISVIRAKELLDVLEDEVQLKA
LLKQQRPIYIFEKMKVIDAINTLRTSKGSLVLVNDEFGNIQGLISPLDVFEAIAGEFPDA
DEQLDLVKIDESTWKAAGSLDLYQLELELGMLDLVEDDADYVSVAGLILDKIQDKITIGT
QLDFRGVHFEVTELEGNRIKTVQITHQS