Protein Info for MPMX26_02127 in Acinetobacter radioresistens SK82

Annotation: tRNA-dihydrouridine synthase B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 347 TIGR00737: putative TIM-barrel protein, nifR3 family" amino acids 16 to 326 (311 residues), 386.9 bits, see alignment E=3.5e-120 PF01207: Dus" amino acids 21 to 324 (304 residues), 330.6 bits, see alignment E=1.4e-102

Best Hits

Swiss-Prot: 60% identical to DUSB_PSEAE: tRNA-dihydrouridine synthase B (dusB) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K05540, tRNA-dihydrouridine synthase B [EC: 1.-.-.-] (inferred from 88% identity to aby:ABAYE0965)

Predicted SEED Role

"tRNA dihydrouridine synthase B (EC 1.-.-.-)" (EC 1.-.-.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (347 amino acids)

>MPMX26_02127 tRNA-dihydrouridine synthase B (Acinetobacter radioresistens SK82)
MSQNTVIRELFDRPIEQKIWVAPMAGVTDRPFRTLCKYFGAGHAVSEMMTADKTLRMSKK
SLYRANFDGELAPISAQIAGSDPEQLAEAARYQIANGAQIIDINMGCPAKKVCNKLAGSA
LLQDEELVARILDTVVAAVDVPVTLKTRLGYLNGQENILRVAKRAEEAGIAALALHGRTR
EDMYLNHARYDLIREVKKIIHIPVIANGDIDSPEKAKFVLEHTGADAIMIGRAAQGRPWI
FREIAHYLNTGEYLKAPDIEEVKHVLLGHLNELYEFYGEYSGCRIARKHIAWYTKGLYAS
NEFRQKMYQVESTLEQAKVVEAYFNQLLAQGRLMSDVQQETVNLLDP