Protein Info for MPMX26_02115 in Acinetobacter radioresistens SK82

Annotation: L-lactate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 404 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 47 to 66 (20 residues), see Phobius details amino acids 78 to 97 (20 residues), see Phobius details amino acids 103 to 127 (25 residues), see Phobius details amino acids 139 to 160 (22 residues), see Phobius details amino acids 167 to 188 (22 residues), see Phobius details amino acids 222 to 244 (23 residues), see Phobius details amino acids 257 to 278 (22 residues), see Phobius details amino acids 287 to 307 (21 residues), see Phobius details amino acids 311 to 334 (24 residues), see Phobius details amino acids 342 to 365 (24 residues), see Phobius details amino acids 377 to 396 (20 residues), see Phobius details PF07690: MFS_1" amino acids 19 to 361 (343 residues), 142.1 bits, see alignment E=2.1e-45 PF13347: MFS_2" amino acids 144 to 336 (193 residues), 28.9 bits, see alignment E=4.4e-11

Best Hits

KEGG orthology group: None (inferred from 84% identity to abb:ABBFA_001114)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (404 amino acids)

>MPMX26_02115 L-lactate transporter (Acinetobacter radioresistens SK82)
MLTTQFSKPLIYMLIASAFILALSLGVRHSFGLYLVPMSHEFGWGHHVFSLAIAMQNLIW
GAVQPFTGALADKYGSKIVVALGGALYTAGLVLMAFSSTGLLLNLSVGLILGFALSATSF
SVLLSAVGRAAPPEKRSMAMGIASAAGSFGQFIMLPATLLLLKSIGWSAALMVCAVLVAF
IIPLAWMLKAPHYQSPKVISEALKPALTFKQVLHIVRKHRPFWWLALGFLVCGFQVVFLG
VHLPGYLIDHGFDATTGTIFLALVGLFNIIGTYGAGWLGDRYSKPKLLMLLYGIRGIAII
AFLALPLTTISVYIFGMVMGILWLSTVPLTNGIVANMFGVKYLSMLSGIVFFTHQIGSFF
GGWLGGVNHDIAGNYNAVWLTAIVLSVLGVFVHFFVNEEAVVHD