Protein Info for MPMX26_02057 in Acinetobacter radioresistens SK82

Annotation: IS3 family transposase ISAba21

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 284 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details PF13276: HTH_21" amino acids 40 to 95 (56 residues), 35 bits, see alignment E=2.8e-12 PF00665: rve" amino acids 119 to 217 (99 residues), 93.2 bits, see alignment E=2.2e-30 PF13683: rve_3" amino acids 209 to 272 (64 residues), 33 bits, see alignment E=8.3e-12 PF13333: rve_2" amino acids 224 to 274 (51 residues), 48.6 bits, see alignment 1.5e-16

Best Hits

Swiss-Prot: 47% identical to YIS2_SHISO: Insertion element IS600 uncharacterized 31 kDa protein from Shigella sonnei

KEGG orthology group: None (inferred from 61% identity to prw:PsycPRwf_1356)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (284 amino acids)

>MPMX26_02057 IS3 family transposase ISAba21 (Acinetobacter radioresistens SK82)
MKQQRYLFPISFMARLLHVSVSRFYDWLKRGMNKRLVQRNQQTILVKIAHEETKQSYGYI
RLTKHLQAQGIKISTYAVRQIKKLNQLYCKRHKRFKRTTKSDHNRAIYANLLEQQFSMTK
PNLAWSSDITYIWTAEGWLYLAAVKDLYTKQVVGYSLNERMTAQLVCNALTMAIRNQKPT
KGLIIHSDRGSQYCSHEYRKILEKCDFQGSMSKRGDCYDNAPIESFWGILKNELVHHCNY
KTRDEAKADITEYIVLFYNQRRIQKSLDFKTPNQIAENFYRLAA