Protein Info for MPMX26_02044 in Acinetobacter radioresistens SK82

Annotation: TelA-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 376 PF05816: TelA" amino acids 43 to 364 (322 residues), 254 bits, see alignment E=1.1e-79

Best Hits

Swiss-Prot: 47% identical to KLAB_ECOLX: Protein KlaB (klaB) from Escherichia coli

KEGG orthology group: None (inferred from 77% identity to aci:ACIAD2252)

Predicted SEED Role

"putative tellurique resistant protein (KlaB/TelA)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (376 amino acids)

>MPMX26_02044 TelA-like protein (Acinetobacter radioresistens SK82)
MADLEKNDLTIVTSRDLSEQDFQQLNLQEIGLKDSDFTEVQNAHKELNDMSHHTVAEYGK
NIATKTSSYTDELLDLVQNKDLDATGQKLNQVVQVAQQLNTSSILNKPKSSGFLGNLLGK
IKGAKQNFDQQFHTTKEQIDVLVKEIEISQTGLKARVDTLDKMFNGVQDEYRQLGIYVAA
GKLKQQDIQQQIAKLSEQPQDQPITQKIYDLNHLANNLEKRISDLQVLQQSAMQTLPMIR
IIQSNNLMLVDKFYAIKNITLPAWKNQISLAISLNEQKNSVQLANSIDDATNELLRRNAE
LLHQNSVDTAKANQRSVIDIETLEHVQNTLIKTVNDVIQVQKEGMQKRQEATSRLRMLQD
NLNQLVLESNSGTNKP