Protein Info for MPMX26_02034 in Acinetobacter radioresistens SK82

Annotation: Transcriptional regulatory protein QseB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF06490: FleQ
  • amino acids 2 to 84 (83 residues), 22.6 bits, E=1.6e-08
• PF00072: Response_reg
  • amino acids 3 to 113 (111 residues), 100.2 bits, E=1.2e-32
• PF00486: Trans_reg_C
  • amino acids 146 to 216 (71 residues), 80.3 bits, E=1.4e-26

Best Hits

Swiss-Prot: 45% identical to QSEB_ECOLI: Transcriptional regulatory protein QseB (qseB) from Escherichia coli (strain K12)

KEGG orthology group: K02483, two-component system, OmpR family, response regulator (inferred from 70% identity to abb:ABBFA_001155)

Predicted SEED Role

"Two-component system response regulator QseB" in subsystem Orphan regulatory proteins

Protein Sequence (219 amino acids)

>MPMX26_02034 Transcriptional regulatory protein QseB (Acinetobacter radioresistens SK82)
MRILLVEDDTSQGESIKTWLELDGYSVDWVERGDYAMTALKQHDYECILLDRGLPYASGD
EILKTLRQHQAQTPVIFLTARDSISDRVEGLDLGANDYLVKPFSLEELSARIRSQMRNLQ
AGQSQTLIWNNICLDPKAKTVQQEGESRDLTAREFQILYKLMQHPNHVVTREQLEESIYA
WGDEVESNAIEVYIYQLRKKLGSQTIRTIRGLGYRMGEA