Protein Info for MPMX26_01979 in Acinetobacter radioresistens SK82

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 189 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 37 to 58 (22 residues), see Phobius details amino acids 65 to 82 (18 residues), see Phobius details amino acids 89 to 108 (20 residues), see Phobius details amino acids 113 to 131 (19 residues), see Phobius details amino acids 141 to 165 (25 residues), see Phobius details PF04955: HupE_UreJ" amino acids 13 to 185 (173 residues), 93.5 bits, see alignment E=5.6e-31

Best Hits

KEGG orthology group: K03192, urease accessory protein (inferred from 61% identity to abb:ABBFA_002591)

Predicted SEED Role

"HupE-UreJ family metal transporter" in subsystem Transport of Nickel and Cobalt or Urea decomposition

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (189 amino acids)

>MPMX26_01979 hypothetical protein (Acinetobacter radioresistens SK82)
MKNIIQRASLIMLGLIPEVSQAHPGHDHHSGFSAGFLHPFTGMDHMIMALALGVLLWSAA
RQWKILGMASMATALVFGFVLGQQQLFSSSLAEYGIIASLLMVTLALWSKSRIILPVATA
LLVTFHGIAHGNELGHSGHIAGLVSGMIIAMSLIYIAGLGLGALIIRYIPYGKKIVGACA
AIVALIGLT