Protein Info for MPMX26_01978 in Acinetobacter radioresistens SK82

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 535 transmembrane" amino acids 41 to 66 (26 residues), see Phobius details amino acids 72 to 94 (23 residues), see Phobius details amino acids 106 to 130 (25 residues), see Phobius details amino acids 141 to 165 (25 residues), see Phobius details amino acids 175 to 194 (20 residues), see Phobius details amino acids 214 to 234 (21 residues), see Phobius details amino acids 255 to 284 (30 residues), see Phobius details amino acids 309 to 330 (22 residues), see Phobius details amino acids 354 to 375 (22 residues), see Phobius details amino acids 383 to 405 (23 residues), see Phobius details amino acids 425 to 446 (22 residues), see Phobius details amino acids 452 to 472 (21 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 89% identity to acd:AOLE_11730)

Predicted SEED Role

"PROBABLE CONSERVED TRANSMEMBRANE PROTEIN"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (535 amino acids)

>MPMX26_01978 hypothetical protein (Acinetobacter radioresistens SK82)
MHNSSATDVLENSPSSAANETLEDYTLRYAPHSFRRWSPKVVAITALGGIAYLADFSIGA
SIGMAYGTTNAVFSILFAALIIFLTGIPLAYYAARYNIDLDLITRGAGFGYFGSVLTSII
FASFTFIFFALEGSIMAQGLLLGLGIPLWAGYLVSTVLVIPLVIYGMKALTKLQVWTTPI
WLILMIGPVAYLIYQEPDLISQFAAYGGNEGFAVLDMAAIMLGAGICLSLIMQIGEQIDY
LRFMPAKTKENSKSWWIAVISAGPGWVILGAIKQIIGAFLGFYLLTKIPDVNSTEPVQQF
NAAFHDMLPGWLALSLAVILVVISQIKINVTNAYSGSLAWTSAYTRITKHYPGRIIFVMV
NLAIALALMEGNMFAVLGKILGFYSNFAIAWVVVVATDIAINKYVLKLSPKEPEYRRDML
YNINPVGMVSFLVAAGLSIAAFFGLLGEFLAPYSPLIALLVAFILTPLMGLLTKGKYYIK
NSNDGLKEARYDTEGTPVATVYHCVACNENYERPDVMYSHRHSGVICSLCKTMEK