Protein Info for MPMX26_01945 in Acinetobacter radioresistens SK82

Annotation: L-lysine N6-monooxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 469 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details PF13434: Lys_Orn_oxgnase" amino acids 1 to 340 (340 residues), 361.3 bits, see alignment E=7.9e-112 PF13454: NAD_binding_9" amino acids 7 to 150 (144 residues), 27.7 bits, see alignment E=3.7e-10

Best Hits

KEGG orthology group: None (inferred from 70% identity to aci:ACIAD2123)

MetaCyc: 64% identical to 1,3-diaminopropane N-monooxygenase (Acinetobacter baumannii AYE)
1.14.13.M65 [EC: 1.14.13.M65]

Predicted SEED Role

"Probable Lysine n(6)-hydroxylase associated with siderophore S biosynthesis (EC 1.14.13.59) @ Siderophore biosynthesis protein, monooxygenase" (EC 1.14.13.59)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.13.59 or 1.14.13.M65

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (469 amino acids)

>MPMX26_01945 L-lysine N6-monooxygenase (Acinetobacter radioresistens SK82)
MLDFIGIGLGPFNLSLAALLHQQSSLKYQFFEKHQDFDWHAGIQLPNAMMQVPFMADLVS
LVEPTSPYSFLNYLKAHQRLYKFYFRENLYIPRQEYNHYCQWVVQQLEHLQFGSRVTDIA
PILGGFQVITEQKGRLSVHQTRKLVLGTGTTPKLPQPLQRIAEQHPHCLHSSNYLHQGDQ
QLSGNVVLIGSGQSAAEIFIDLFDRQINPETGQAKFHLYWLTRSAGFFPMENTPLGLESF
SPDYMSYFYHLSQDLKTTLPATQANLYKGISAKTIRDIYERLYQRSIGAVDTHVTLAGHY
HLENAQLVHGKNIQLKFLQTQKQQNLNIQASTVIAATGYQYPSLDFLNKLGSKIGLNLQH
QWEINENHQLNYQGDGEIYVQNTDLQHHGIGTPDLGLGAFRSAKIANQILGKTYFEIEGR
QSFQDFQIKEIEASFAMPAAIAKSNFRTDVISSPISKKVADLFPQYSMK