Protein Info for MPMX26_01944 in Acinetobacter radioresistens SK82

Annotation: Putative multidrug resistance protein MdtD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 478 transmembrane" amino acids 21 to 38 (18 residues), see Phobius details amino acids 57 to 78 (22 residues), see Phobius details amino acids 88 to 108 (21 residues), see Phobius details amino acids 118 to 137 (20 residues), see Phobius details amino acids 149 to 171 (23 residues), see Phobius details amino acids 177 to 196 (20 residues), see Phobius details amino acids 208 to 227 (20 residues), see Phobius details amino acids 239 to 257 (19 residues), see Phobius details amino acids 278 to 301 (24 residues), see Phobius details amino acids 307 to 326 (20 residues), see Phobius details amino acids 346 to 377 (32 residues), see Phobius details amino acids 409 to 428 (20 residues), see Phobius details amino acids 447 to 466 (20 residues), see Phobius details PF07690: MFS_1" amino acids 27 to 418 (392 residues), 157.3 bits, see alignment E=5e-50 amino acids 281 to 467 (187 residues), 39.7 bits, see alignment E=3e-14 PF00083: Sugar_tr" amino acids 54 to 197 (144 residues), 36.7 bits, see alignment E=2.4e-13

Best Hits

KEGG orthology group: None (inferred from 66% identity to aci:ACIAD2122)

Predicted SEED Role

"Permease of the major facilitator superfamily in uncharacterized siderophore S biosynthesis operon"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (478 amino acids)

>MPMX26_01944 Putative multidrug resistance protein MdtD (Acinetobacter radioresistens SK82)
MAEISNSDSRSVSDPDLSQRWVMLSVMLGTGTVSLNNSSFNPAIPQLMQDFQIAEAAVSW
VVVVFLLTMSLSLLLTGFLSQRFGQRQVYLSALSIFMLSSVCGLFASGFETVLAVRALQG
FASGLMIPLSLGIIFSVTPKQQRGSATGLWGAMIMLTLACGPMLGALLLVWFSWQVLFLL
NVPLALAALAIGWLYLPKQSLIRNLKFDWFGFSLLAVSIISLLLGLSTIKQWADFSRSLF
WWLFGLSGLSGFGFIWFSRKRTSTIIAWPLFQSREFNYSLIISIVHTVGLFISLLLIPLL
VQNTLQLSPIWTGLLLMSSALATSLCSKHAGKYLDQHGAKRLISFGLLLTAIAFIGLGLA
AGLSISLLIFCMIIHGLGFGLSYMPATTAGLNHLHNPELVTQGAAVNNLFRRLCSAVAVV
MAALYLQIRTQHLLLNHELPIAQLYAIRELFFFCAGMMLLGLSYAWKFPHSKQSTLHV