Protein Info for MPMX26_01938 in Acinetobacter radioresistens SK82

Annotation: Ferric aerobactin receptor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 732 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF07715: Plug" amino acids 55 to 157 (103 residues), 64.5 bits, see alignment E=1.2e-21 TIGR01783: TonB-dependent siderophore receptor" amino acids 56 to 731 (676 residues), 240.9 bits, see alignment E=1.6e-75 PF00593: TonB_dep_Rec_b-barrel" amino acids 252 to 693 (442 residues), 125 bits, see alignment E=7.7e-40

Best Hits

KEGG orthology group: None (inferred from 70% identity to abc:ACICU_01679)

Predicted SEED Role

"Outer membrane receptor proteins, likely involved in siderophore uptake @ TonB-dependent siderophore receptor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (732 amino acids)

>MPMX26_01938 Ferric aerobactin receptor (Acinetobacter radioresistens SK82)
MRLSQFSLCFLTVAISSLLYAEDSGSELKELKNSDKTMKLSPIVVTATRTPKTIAEIAGT
VQTIQGEDIAQQAGASRKVADVLAQLVPSLAPSSGTTSNYGQTMRGRNVLVMIDGVSQTG
SRDVARQLNSISPNMIDHIEVVSGATSIYGSGATGGIINIITKRADKSKPFSFQTKLGLT
SADNFRRDSLAYQVGQTASFNNDKMDGFLGVDYTSRGSQFDGKDNRIPLSPWQGSTMDTN
TLDVNGRLNFNLTDQQSLSFGTQYYNDEQDTEYGPDYSYLQKGTQPSYKAIKGWSLDKQP
FTERYAFNTQYQNQDFLGQTLNIEAYYRNEKARFVPYGYSKDGVDVKQSQSNVDYAGIRS
TVQSDLQVADRALRLTYGLDYDGEKDHQWADYYKPSNNGLVYTPTGKKESAGPDTRIQNI
GTFVQGDYAITDRLNIQAGVRYQYVQADTDSYFTARKPITLMAADSTDSDKLLFNLGTVY
ELTDIQQVYANFSQGYSYPDVQRVLRDGVAGYTLTTSGIAPITVNSYELGWRLNQDNGIN
LALTGFYNTSDKVVQFNSDRSVNVVDTDQRIYGAEATVSYPFIENYKVGGTLGYTRGQYK
DVANNWHELNAFAVSPTKGTLFAEWSNEQGYGVRAQIQAIKGTDKAYKDDQALKAAGLTD
SNSAAEIKGYTTMDVLAHFPMAKGRVDFGIYNLWDRQYKTVFAQQAAVTNDNPILAIPAE
GRTFGLSYTINY