Protein Info for MPMX26_01932 in Acinetobacter radioresistens SK82

Annotation: 1,4-dihydroxy-2-naphthoyl-CoA synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 TIGR03210: 2-ketocyclohexanecarboxyl-CoA hydrolase" amino acids 3 to 258 (256 residues), 527.9 bits, see alignment E=1.8e-163 PF00378: ECH_1" amino acids 10 to 256 (247 residues), 238.6 bits, see alignment E=6.9e-75 PF16113: ECH_2" amino acids 15 to 251 (237 residues), 87.3 bits, see alignment E=1.5e-28

Best Hits

Swiss-Prot: 50% identical to MENB_ECOLI: 1,4-dihydroxy-2-naphthoyl-CoA synthase (menB) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 91% identity to adk:Alide2_4103)

MetaCyc: 87% identical to BadI (Rhodopseudomonas palustris)
3.7.1.-

Predicted SEED Role

No annotation

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (260 amino acids)

>MPMX26_01932 1,4-dihydroxy-2-naphthoyl-CoA synthase (Acinetobacter radioresistens SK82)
MNFEDILYEVKNGVAWITINRPEKMNAFRGTTCNELIKALNRAGYDRNVGAIVLAGAGEK
AFCTGGDQSAHDGNYDGRGTIGLPMEELHTAIRDVPKPVIARVQGYAIGGGNVLATICDL
TICSDKAIFGQVGPKMGSVDPGYGTAFLARVVGEKKAREIWYMCRRYSGQEAVEMGLANK
CVPADQLDAEVQAWAEEICQRSPTAIAIAKRSFNMDTAHQAGIAGMGMYALKLYYDTEES
REGVNALKEKRQPEFRKYAK