Protein Info for MPMX26_01931 in Acinetobacter radioresistens SK82

Annotation: Acyl-CoA dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 385 PF02771: Acyl-CoA_dh_N" amino acids 8 to 119 (112 residues), 86.2 bits, see alignment E=4.2e-28 TIGR03207: cyclohexanecarboxyl-CoA dehydrogenase" amino acids 8 to 378 (371 residues), 696.3 bits, see alignment E=3.6e-214 PF02770: Acyl-CoA_dh_M" amino acids 124 to 218 (95 residues), 65.5 bits, see alignment E=7.9e-22 PF00441: Acyl-CoA_dh_1" amino acids 230 to 376 (147 residues), 137.1 bits, see alignment E=1.1e-43 PF08028: Acyl-CoA_dh_2" amino acids 246 to 356 (111 residues), 35.8 bits, see alignment E=1.8e-12

Best Hits

KEGG orthology group: K04117, cyclohexanecarboxyl-CoA dehydrogenase [EC: 1.3.99.-] (inferred from 80% identity to pna:Pnap_2125)

MetaCyc: 78% identical to AliB (Rhodopseudomonas palustris)
R282-RXN [EC: 1.3.8.11]

Predicted SEED Role

"Acyl-CoA dehydrogenase, short-chain specific (EC 1.3.99.2)" in subsystem Isoleucine degradation (EC 1.3.99.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.-, 1.3.99.2

Use Curated BLAST to search for 1.3.8.11 or 1.3.99.- or 1.3.99.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (385 amino acids)

>MPMX26_01931 Acyl-CoA dehydrogenase (Acinetobacter radioresistens SK82)
MKKNPYITEELEFLAETAEKFAQKYIAPGFLERDQSRIFDRDLVKKMGEMGFIAPELPEQ
FGGQGMGRLAAGIIHEAIAKADLSFSYINLLASLNGQILAEHGQPEVVEPWLKKLTAGEA
IFSIALTEPRGGSDAANLRLKIERDGDEYIINGEKTSISVADQADASVVFGRTGANEDSA
HGVTALLVPMNLPGISTTRFDCHGQRAIGRGSIFFDNVRVPINHRLGDENKGFVQVMQGF
DFSRALIGLQVLAVARVSLDEAWEYAAQREAFGQPLTAFQGVSHPLAEYETQVEAARLLC
LQTLWLKDNHLPHTSEAGMCKWWGPKLAYDVIHQCLLTFGHAGYDRGVMEQRMRDVLGFQ
IGDGTAQIMKTIIARHKAGRKAVPA