Protein Info for MPMX26_01931 in Acinetobacter radioresistens SK82

Annotation: Acyl-CoA dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02771: Acyl-CoA_dh_N
  • amino acids 8 to 119 (112 residues), 86.2 bits, E=4.2e-28
• TIGR03207: cyclohexanecarboxyl-CoA dehydrogenase
  • amino acids 8 to 378 (371 residues), 696.3 bits, E=3.6e-214
• PF02770: Acyl-CoA_dh_M
  • amino acids 124 to 218 (95 residues), 65.5 bits, E=7.9e-22
• PF00441: Acyl-CoA_dh_1
  • amino acids 230 to 376 (147 residues), 137.1 bits, E=1.1e-43
• PF08028: Acyl-CoA_dh_2
  • amino acids 246 to 356 (111 residues), 35.8 bits, E=1.8e-12

Best Hits

KEGG orthology group: K04117, cyclohexanecarboxyl-CoA dehydrogenase [EC: 1.3.99.-] (inferred from 80% identity to pna:Pnap_2125)

MetaCyc: 78% identical to AliB (Rhodopseudomonas palustris)
R282-RXN [EC: 1.3.8.11]

Predicted SEED Role

"Acyl-CoA dehydrogenase, short-chain specific (EC 1.3.99.2)" in subsystem Isoleucine degradation (EC 1.3.99.2)

MetaCyc Pathways

• cyclohexane-1-carboxylate degradation (anaerobic) (2/2 steps found)
• pyruvate fermentation to butanol II (engineered) (4/6 steps found)
• pyruvate fermentation to hexanol (engineered) (7/11 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (18/27 steps found)
• crotonate fermentation (to acetate and cyclohexane carboxylate) (4/16 steps found)
• benzoate fermentation (to acetate and cyclohexane carboxylate) (4/17 steps found)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Benzoate degradation via CoA ligation
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Brassinosteroid biosynthesis
• Butanoate metabolism
• Caprolactam degradation
• Fatty acid metabolism
• Geraniol degradation
• Valine, leucine and isoleucine degradation

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.-, 1.3.99.2

Use Curated BLAST to search for 1.3.8.11 or 1.3.99.- or 1.3.99.2

Protein Sequence (385 amino acids)

>MPMX26_01931 Acyl-CoA dehydrogenase (Acinetobacter radioresistens SK82)
MKKNPYITEELEFLAETAEKFAQKYIAPGFLERDQSRIFDRDLVKKMGEMGFIAPELPEQ
FGGQGMGRLAAGIIHEAIAKADLSFSYINLLASLNGQILAEHGQPEVVEPWLKKLTAGEA
IFSIALTEPRGGSDAANLRLKIERDGDEYIINGEKTSISVADQADASVVFGRTGANEDSA
HGVTALLVPMNLPGISTTRFDCHGQRAIGRGSIFFDNVRVPINHRLGDENKGFVQVMQGF
DFSRALIGLQVLAVARVSLDEAWEYAAQREAFGQPLTAFQGVSHPLAEYETQVEAARLLC
LQTLWLKDNHLPHTSEAGMCKWWGPKLAYDVIHQCLLTFGHAGYDRGVMEQRMRDVLGFQ
IGDGTAQIMKTIIARHKAGRKAVPA